1.67 Rating by CuteStat

trafficticketlawyerhempstead.com is 9 years 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, trafficticketlawyerhempstead.com is SAFE to browse.

PageSpeed Score
72
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

198.1.94.232

Hosted Country:

United States of America US

Location Latitude:

40.2181

Location Longitude:

-111.6133
Traffic Ticket Lawyer Hempstead

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 5
H3 Headings: 7 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 17
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 198.1.94.232)

Dui Lawyer Anniston

- duilawyeranniston.com

Dui Lawyer Anniston. Anniston, Alabama attorneys with Criminal, drunk driving Experience. Find a Anniston Alabama DUI attorney or law firm.

Not Applicable $ 8.95

Drug Lawyer Louisville

- druglawyerlouisville.com

Drug Lawyer Louisville. Louisville, Kentucky attorneys with Criminal, drunk driving Experience. Find a Louisville Kentucky drug attorney or law firm.

Not Applicable $ 8.95

Immigration Attorney Stewart

- immigrationattorneystewart.com

Immigration Attorney Stewart. Stewart County, Georgia attorneys with immigration experience including green cards, visas, and citizenship, including eligibility, sponsorship, interviews, and exams. Find a Stewart County Georgia immigration attorney or law firm.

Not Applicable $ 8.95

Immigration Attorney Etowah

- immigrationattorneyetowah.com

Immigration Attorney Etowah. Georgia attorneys with immigration experience including green cards, visas, and citizenship, including eligibility, sponsorship, interviews, and exams. Find a Georgia immigration attorney or law firm.

Not Applicable $ 8.95

DWI Attorney Hempstead

- dwiattorneyhempstead.com

DWI Attorney Hempstead

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 23 Apr 2015 14:18:39 GMT
Server: Apache/2.2.17 (Unix) mod_ssl/2.2.17 OpenSSL/0.9.8m DAV/2 mod_auth_passthrough/2.1 mod_bwlimited/1.4
X-Powered-By: PHP/5.2.16
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Mar 18, 2015, 12:00 AM 9 years 1 month 2 weeks ago
Last Modified: Apr 14, 2015, 12:00 AM 9 years 3 weeks 3 days ago
Expiration Date: Mar 18, 2016, 12:00 AM 8 years 1 month 3 weeks ago
Domain Status:
clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.micrositedesigncompany.com 209.59.154.88 United States of America United States of America
ns2.micrositedesigncompany.com 209.59.154.88 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
trafficticketlawyerhempstead.com A 14394 IP: 198.1.94.232
trafficticketlawyerhempstead.com NS 21599 Target: ns1.micrositedesigncompany.com
trafficticketlawyerhempstead.com NS 21599 Target: ns2.micrositedesigncompany.com
trafficticketlawyerhempstead.com SOA 21599 MNAME: ns1.micrositedesigncompany.com
RNAME: server.micrositedesigncompany.com
Serial: 2015041503
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
trafficticketlawyerhempstead.com MX 14399 Target: trafficticketlawyerhempstead.com

Full WHOIS Lookup

Domain Name: TRAFFICTICKETLAWYERHEMPSTEAD.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Richard Baker
Registrant Organization:
Name Server: NS1.MICROSITEDESIGNCOMPANY.COM
Name Server: NS2.MICROSITEDESIGNCOMPANY.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=TRAFFICTICKETLAWYERHEMPSTEAD.COM

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.